Customer Service: (855) 848-6626 | 8:00 a.m - 4:30 p.m. PST | Save 35% on Ghost Dyes™

Recombinant Mouse IL-21 (Carrier-free)
  • Recombinant Mouse IL-21 (Carrier-free)

Recombinant Mouse IL-21 (Carrier-free)

Cat No. Size Price Quantity
21-8211-U002 2 µg $66.00
21-8211-U010 10 µg $185.00
21-8211-U100 100 µg $880.00
21-8211-U500 500 µg $2,560.00

Description

IL-21 is expressed in activated human CD4+ cells and expression is upregulated in Th2, Th17, and Tfh T cell subsets. IL-21 acts on T, B, NKT and NK cells which bear the IL-21R gamma chain paired with other IL-2 receptor family members. IL-21 is important in B cell proliferation and T:B interactions leading to B cell differentiation and antibody production. Interleukin-21 is also produced by Hodgkin’s Lymphoma cancer cells which is somewhat surprising as IL-21 was thought to be restricted to production by CD4+ cells.
View More
IL-21 is expressed in activated human CD4+ cells and expression is upregulated in Th2, Th17, and Tfh T cell subsets. IL-21 acts on T, B, NKT and NK cells which bear the IL-21R gamma chain paired with other IL-2 receptor family members. IL-21 is important in B cell proliferation and T:B interactions leading to B cell differentiation and antibody production. Interleukin-21 is also produced by Hodgkin’s Lymphoma cancer cells which is somewhat surprising as IL-21 was thought to be restricted to production by CD4+ cells.
Hide

Product Details

Name Recombinant Mouse IL-21 (Carrier-free)
Cat. No. 21-8211
Alternative Names
Amino Acid Sequence MHKSSPQGPDRLLIRLRHLIDIVEQLKIYENDLDPELLSAPQDVKGHCEHAAFACFQKAKLKPSNPGNNKTFIIDLVAQLRRRLPARRGGKKQKHIAKCPSCDSYEKRTPKEFLERLKWLLQKMIHQHLS
Authenticity Verified by N-terminal and Mass Spectrometry analyses (when applicable).
Bioactivity ED50 is calculated as 15-20 ng/ml by anti-hCD40 mAb induced proliferation in mouse splenocytes.
Endotoxin Level Endotoxin level is <0.1 ng/μg of protein (<1 EU/μg).
Molecular Mass Recombinant Mouse IL-21 is a 15.0 kDa protein composed of 130 amino acid residues.
Protein Content Content Verified by UV Spectroscopy and/or SDS-PAGE gel.
Purity (%) 98
Source E. coli
Reactivity Mouse
Research Areas Apoptosis; Cancer; Immune System; Stem Cells & Differentiation
Reconstitution See Certificate of Analysis (COA) for lot specific reconstitution information.
Application Bioassay
Application Key:

FC = Flow Cytometry; FA = Functional Assays; ELISA = Enzyme-Linked Immunosorbent Assay; ICC = Immunocytochemistry; IF = Immunofluorescence Microscopy; IHC = Immunohistochemistry; IHC-F = Immunohistochemistry, Frozen Tissue; IHC-P = Immunohistochemistry, Paraffin-Embedded Tissue; IP = Immunoprecipitation; WB = Western Blot; EM = Electron Microscopy

*Tonbo Biosciences tests all antibodies by flow cytometry. Citations are provided as a resource for additional applications that have not been validated by Tonbo Biosciences. Please choose the appropriate format for each application and consult the Materials and Methods section for additional details about the use of any product in these publications.